PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC03G30190.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family TALE
Protein Properties Length: 793aa    MW: 82311 Da    PI: 6.5896
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC03G30190.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.42.8e-095866231954
                      HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
         Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                      Fe   ++yps +++  LA+++gL+ +qV++WF N R +
  OPUNC03G30190.1 586 FEHflHPYPSDADKHLLARQTGLSRNQVSNWFINARVR 623
                      564459******************************88 PP

2BELL84.31.4e-274665172172
             BELL  21 krYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                       rY++y++q+q+v++ F+ v+g g+a+pYt+lA+ka+SrhFrcLkdaia q+
  OPUNC03G30190.1 466 SRYNHYCDQMQMVVNFFDSVMGFGAATPYTALAQKAMSRHFRCLKDAIAAQL 517
                      69***********************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.2E-41403515IPR006563POX domain
PfamPF075268.6E-7408452IPR006563POX domain
PfamPF075261.7E-24466514IPR006563POX domain
PROSITE profilePS5007112.6564627IPR001356Homeobox domain
SMARTSM003891.6E-9567631IPR001356Homeobox domain
CDDcd000864.61E-13567628No hitNo description
SuperFamilySSF466892.69E-17569634IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-28570633IPR009057Homeodomain-like
PfamPF059204.0E-18584623IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009965Biological Processleaf morphogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 793 aa     Download sequence    Send to blast
MERRRLSPPL PDNDVLLLLL ILAAEEEEGL FVGRRSTADD GDSGAAGMGI AAPPCQPGQT  60
TTFVSQPTKS SAAAIRPPAT ASSSSMSHSQ GFHQASSGVF GFSSDGFDRP GSSQDPQQHE  120
QQQQHVAQQS RRDKLRVQGF DPAAAAAGHG LLPIEGDEHG AEPAAMYDHA EAAAGASNML  180
SEMFNFPSQP PTGPSATELL ASQMNANYRF GFRQAAGGVA GLAGGEGGWF GGGAAGRTGL  240
VLGGASLGSL GETSSPKQQA GGMAGLATDP AAAMHLFLMN PQQQQSRSST SPPPSDAQSA  300
IHQHHEAFQA FGGAGAPFGG GAAGVVEGQG LSLSLSPSLQ QLEMAKQAEE LRVRDGVLYF  360
NRQQQQQQQQ AAAAAASVQQ LPMALHGQVG ALGQQLHVGY GPAGVAGVLR NSKYTRAAQE  420
LLEEFCSVGR GQIKGGRGSA PNNPNSSKAG GAAAAASSSG AAQSPSRYNH YCDQMQMVVN  480
FFDSVMGFGA ATPYTALAQK AMSRHFRCLK DAIAAQLRHT CELLGEKDAG TSSGLTKGET  540
PRLRAIDQSL RQQRAFHHMG IMEQEAWRPQ RGLPERSVNI LRSWLFEHFL HPYPSDADKH  600
LLARQTGLSR NQVSNWFINA RVRLWKPMIE EMYQQECKEL EGSSGGGGGA GGPESGNDPS  660
GADDTHSPTT TGGAHHQHRH QVEHGASSGA AMSHKHEPGV VAGPSSSSAV AADAAFVGID  720
PVELLGGDAH VGAADDLYGR FEPAGVRVRY GPAAAAGAAA GDVSLTLGLQ HAGAGNAGPD  780
GSGRFSLRDY SGC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5bng_A1e-17573631159Homeobox protein Meis2
5bng_B1e-17573631159Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1035500.0AC103550.13 Oryza sativa chromosome 3 BAC OSJNBa0079G12 genomic sequence, complete sequence.
GenBankAK2874760.0AK287476.1 Oryza sativa Japonica Group cDNA, clone: J043023B19, full insert sequence.
GenBankAP0149590.0AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004981881.10.0PREDICTED: BEL1-like homeodomain protein 4
TrEMBLA0A0E0KIM50.0A0A0E0KIM5_ORYPU; Uncharacterized protein
STRINGMLOC_58467.30.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44332945
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36870.21e-113BEL1-like homeodomain 2